| ID | DRAMP04356 |
|---|---|
| Sequence | KWKLFKKIEKVGQRVDAVISAGPAVATVAQAATALAK |
| Length | 37 |
| Name | CAD |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22651919 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | KWKLFKKIEKVGQRVDAVISAGPAVATVAQAATALAK |
| Molecular Weight | 3865.568 |
| Grand Average of Hydropathy | 0.249 |
| Isoelectric Point | 10.295 |
| Charge at pH 7.4 | 4.544 |
| Secondary Structure | Helix: 0.297, Turn: 0.108, Sheet: 0.324 |
| Instability Index | 9.508 |
| Aromaticity | 0.054 |