Basic Information
| ID | DRAMP02768 |
|---|
| Sequence | GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ |
|---|
| Length | 56 |
|---|
| Name | Pilosulin-1 (Myr b I; ants, insects, animals) |
|---|
| Source | Myrmecia banksi (Jack jumper ant) (Australian jumper ant) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | [Ref.9813247]Gram-positive bacteria: Micrococcus luteus (MIC=0.5 µM), Enterococcus spp.I-11305b (MIC=2 µM), Enterococcus spp. I-11054 (MIC=2 µM), Staphylococcus simulans 22 (MIC=2 µM), S. haemolyticus I-10925 (MIC=2 µM), S. epidermidis LT1324 (MIC=2 µM), S. aureuss 5185 (MI=2 µM), S. aureuss methicillin-sensitive I-11574 (MIC=2 µM), S. aureuss (MRSA) LT1338 (MIC=3 µM), S. aureuss (MRSA) LT1334 (MIC=1.5 µM);##Gram-negative bacteria: Citrobacter freundii I-11090 (MIC=2 µM), Klebsiella pneumoniae I-10910 (MIC=2 µM), Escherichia coli I-11276b (MIC=4 µM), E. coli O-19592 (MIC=2 µM), Stenotrophomonas maltophilia O-16451 (MIC=2 µM), S. maltophila I-10717 (MIC=2 µM), Pseudomonas aeruginosa 4991 (MIC=4 µM), Pseudomonas aeruginosa I-10968 (MIC=4 µM);##Fungi: Candida albicans I-11301 (MIC=4 µM), Candida albicans I-11134 (MIC>4 µM). |
|---|
| Hemolytic Activity | [Ref.9813247]Complete lysis in the presence of pilosulin 1 was obtained at a concentration of 40 μM with evidence of partial lysis visible down to 1.25 μM |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q07932, Q9TWC1 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 9813247, 9701394, 15639237, 8866004 |
|---|
