| ID | DRAMP02837 |
|---|---|
| Sequence | PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR |
| Length | 35 |
| Name | Beta-defensin C7 (BBD(C7); mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O18815 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9488394 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR |
| Molecular Weight | 3876.806 |
| Grand Average of Hydropathy | 0.037 |
| Isoelectric Point | 10.224 |
| Charge at pH 7.4 | 7.749 |
| Secondary Structure | Helix: 0.229, Turn: 0.286, Sheet: 0.086 |
| Instability Index | 54.026 |
| Aromaticity | 0.029 |