| ID | DRAMP02881 |
|---|---|
| Sequence | NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCR |
| Length | 36 |
| Name | Antimicrobial protein exons 1-2 (mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Yeast: Candida ablicans. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8506305 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCR |
| Molecular Weight | 3834.678 |
| Grand Average of Hydropathy | 0.119 |
| Isoelectric Point | 9.695 |
| Charge at pH 7.4 | 6.403 |
| Secondary Structure | Helix: 0.222, Turn: 0.306, Sheet: 0.056 |
| Instability Index | 34.083 |
| Aromaticity | 0 |