| ID | DRAMP02858 |
|---|---|
| Sequence | DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW |
| Length | 38 |
| Name | Bovine Beta-defensin 1 (bBD-1; BNBD-1; BNDB-1; mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P46159 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16777238 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW |
| Molecular Weight | 4278.048 |
| Grand Average of Hydropathy | -0.042 |
| Isoelectric Point | 8.983 |
| Charge at pH 7.4 | 3.482 |
| Secondary Structure | Helix: 0.237, Turn: 0.289, Sheet: 0.079 |
| Instability Index | 42.889 |
| Aromaticity | 0.079 |