| ID | DRAMP03425 |
|---|---|
| Sequence | KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK |
| Length | 41 |
| Name | Beta-defensin 3 (BD-3, RBD-3; Defensin, beta 3; Rodents, mammals, animals) |
| Source | Rattus norvegicus (Rat) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q32ZI4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 41 |
|---|---|
| Sequence | KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK |
| Molecular Weight | 4531.422 |
| Grand Average of Hydropathy | -0.305 |
| Isoelectric Point | 9.588 |
| Charge at pH 7.4 | 7.391 |
| Secondary Structure | Helix: 0.220, Turn: 0.244, Sheet: 0.122 |
| Instability Index | 35.512 |
| Aromaticity | 0.073 |