| ID | DRAMP04529 |
|---|---|
| Sequence | FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK |
| Length | 44 |
| Name | LAP-like antimicrobial peptide (Bovine beta-defensins) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q5W5H8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15520886 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK |
| Molecular Weight | 4897.809 |
| Grand Average of Hydropathy | -0.495 |
| Isoelectric Point | 10.846 |
| Charge at pH 7.4 | 9.403 |
| Secondary Structure | Helix: 0.182, Turn: 0.273, Sheet: 0.068 |
| Instability Index | 70.855 |
| Aromaticity | 0.023 |