Basic Information
| ID | DRAMP02824 |
|---|
| Sequence | VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK |
|---|
| Length | 40 |
|---|
| Name | Lingual antimicrobial peptide (mammals, animals) |
|---|
| Source | Bubalus bubalis (Domestic water buffalo) |
|---|
| Activity | Antimicrobial, Antibacterial, Antiviral |
|---|
| Pathogen | Escherichia coli, Staphylococcus aureus, Streptococcus pyogenes, Candida albicans, Rinderpest Virus (RPV) and Newcastle Disease Virus (NDV) |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
A3RJ36 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 18826332 |
|---|
