| ID | DRAMP02797 |
|---|---|
| Sequence | GIINMLQKSYCKIRKGRCALLGCLPKEEQIGSCSVSGRKCCRKKK |
| Length | 45 |
| Name | Beta-defensin 103A (Defensin, beta 103; Defensin, beta 103A; houses, mammals, animals) |
| Source | Equus caballus (Horse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q0W9P9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16723195 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | GIINMLQKSYCKIRKGRCALLGCLPKEEQIGSCSVSGRKCCRKKK |
| Molecular Weight | 5016.103 |
| Grand Average of Hydropathy | -0.416 |
| Isoelectric Point | 9.848 |
| Charge at pH 7.4 | 9.39 |
| Secondary Structure | Helix: 0.222, Turn: 0.244, Sheet: 0.178 |
| Instability Index | 38.691 |
| Aromaticity | 0.022 |