| ID | DRAMP03375 |
|---|---|
| Sequence | DLKHLILKAQLTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCKNIKQF |
| Length | 50 |
| Name | Beta-defensin 10 (BD-10, mBD-10; Defensin, beta 10; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8R2I8, A2A4E8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12644567, 19468303 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | DLKHLILKAQLTRCYKFGGFCHYNICPGNSRFMSNCHPENLRCCKNIKQF |
| Molecular Weight | 5891.901 |
| Grand Average of Hydropathy | -0.42 |
| Isoelectric Point | 9.272 |
| Charge at pH 7.4 | 5.504 |
| Secondary Structure | Helix: 0.280, Turn: 0.240, Sheet: 0.160 |
| Instability Index | 74.62 |
| Aromaticity | 0.12 |