Basic Information
| ID | DRAMP03598 |
|---|
| Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
|---|
| Length | 41 |
|---|
| Name | Human beta-defensin 2 (hBD-2; Defensin, beta 2; Beta-defensin 4A; Human, mammals, animals) |
|---|
| Source | Homo sapiens (Human) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli D31(MIC=62 µg/ml), Escherichia coli ATCC (MIC=62 µg/ml), Pseudomonas aeruginosa ATCC (MIC=62 µg/ml);##Gram-positive bacteria: Staphylococcus aureus ATCC (MIC=62 µg/ml), Enterococcus faecalis ATCC (MIC=15 µg/ml). |
|---|
| Hemolytic Activity | [Ref.15625724] It is slightly hemolytic (<12%) against human erythrocytes at the highest concentration of 500 μg/ml. |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
O15263, Q52LC0 |
|---|
| PDB |
1FD4, 1FD3 resolved by X-ray.##1FQQ |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 9202117, 10906336, 17340092 |
|---|
