| ID | DRAMP02870 |
|---|---|
| Sequence | SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
| Length | 42 |
| Name | Bovine Beta-defensin 13 (bBD-13; BNBD-13; BNDB-13; mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacterium: Staphylococcus aureus (MIC=10-300 µg/ml);##Gram-negative bacterium: Escherichia coli (MIC=10-300 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P46171 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8454635 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
| Molecular Weight | 4450.314 |
| Grand Average of Hydropathy | 0.121 |
| Isoelectric Point | 9.565 |
| Charge at pH 7.4 | 5.104 |
| Secondary Structure | Helix: 0.238, Turn: 0.405, Sheet: 0.048 |
| Instability Index | 48.793 |
| Aromaticity | 0.048 |