| ID | DRAMP02868 |
|---|---|
| Sequence | GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW |
| Length | 38 |
| Name | Bovine Beta-defensin 11 (bBD-11; BNBD-11; BNDB-11; mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacterium: Staphylococcus aureus 502A (MIC=10-300 µg/ml);##Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P46169, Q5W5G7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8454635, 15520886 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW |
| Molecular Weight | 4163.005 |
| Grand Average of Hydropathy | -0.161 |
| Isoelectric Point | 9.994 |
| Charge at pH 7.4 | 6.408 |
| Secondary Structure | Helix: 0.211, Turn: 0.368, Sheet: 0.053 |
| Instability Index | 60.047 |
| Aromaticity | 0.053 |