| ID | DRAMP20789 |
|---|---|
| Sequence | GPLSCGRNGGVCIPIRCPVPNRQIGTCFGRPVKCCRSW |
| Length | 38 |
| Name | Bovine neutrophil Beta-defensin 12 (BNBD-12; cattle, ruminant, mammals; animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | P46170 |
| PDB | 1BNB resolved by NMR |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8454635 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | GPLSCGRNGGVCIPIRCPVPNRQIGTCFGRPVKCCRSW |
| Molecular Weight | 4088.857 |
| Grand Average of Hydropathy | -0.074 |
| Isoelectric Point | 9.567 |
| Charge at pH 7.4 | 5.408 |
| Secondary Structure | Helix: 0.237, Turn: 0.395, Sheet: 0.026 |
| Instability Index | 59.079 |
| Aromaticity | 0.053 |