| ID | DRAMP03931 |
|---|---|
| Sequence | DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPN |
| Length | 39 |
| Name | hPAB-beta (a hBD-2 variant; beta-defensins) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Type strains: Staphylococcus aureus ATCC25923 (MIC=62.5 µg/ml), Staphylococcus aureus ATCC29215 (MIC=62.5 µg/ml), Escherichia coli ATCC29213 (MIC=125 µg/ml), Enterococcus feces ATCC29212 (MIC=250 µg/ml).##Clinical strains: Salmonella typhoid (MIC=62.5 µg/ml), Salmonella typhoid A (MIC=62.5 µg/ml), Shigella dysentery (MIC=62.5 µg/ml), Escherichia coli (MIC=62.5 µg/ml), Staphylococcus aureus (MIC=31.25 µg/ml), Staphylococcus epidermis (MIC=62.5 µg/ml), Enterobacter cloacae (MIC=62.5 µg/ml), Bacillus proteus curious (MIC=62.5 µg/ml), Acinetobacter lwoffii (MIC=62.5 µg/ml), Pseudomonas aeruginosa Pa6 (MIC=125 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15808901 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPN |
| Molecular Weight | 4221.052 |
| Grand Average of Hydropathy | -0.292 |
| Isoelectric Point | 9.303 |
| Charge at pH 7.4 | 5.432 |
| Secondary Structure | Helix: 0.205, Turn: 0.282, Sheet: 0.077 |
| Instability Index | 46.121 |
| Aromaticity | 0.051 |