| ID | DRAMP02909 |
|---|---|
| Sequence | HGVTDSLSCRWKKGICVLTRCPGTMRQIGTCFGPPVKCCRLK |
| Length | 42 |
| Name | Beta-defensin 2 (BD-2; sBD-2; mammals, animals) |
| Source | Ovis aries (Sheep) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O19039 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9478010, 9461419 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | HGVTDSLSCRWKKGICVLTRCPGTMRQIGTCFGPPVKCCRLK |
| Molecular Weight | 4637.594 |
| Grand Average of Hydropathy | -0.076 |
| Isoelectric Point | 9.614 |
| Charge at pH 7.4 | 6.437 |
| Secondary Structure | Helix: 0.238, Turn: 0.238, Sheet: 0.095 |
| Instability Index | 35.217 |
| Aromaticity | 0.048 |