| ID | DRAMP02647 |
|---|---|
| Sequence | DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK |
| Length | 36 |
| Name | Beta-defensin 2 |
| Source | Macaca mulatta (Rhesus monkey) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | Not found |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK |
| Molecular Weight | 3908.687 |
| Grand Average of Hydropathy | -0.142 |
| Isoelectric Point | 9.126 |
| Charge at pH 7.4 | 4.435 |
| Secondary Structure | Helix: 0.222, Turn: 0.250, Sheet: 0.083 |
| Instability Index | 47.05 |
| Aromaticity | 0.056 |