| ID | DRAMP02630 |
|---|---|
| Sequence | GIGDPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Length | 41 |
| Name | Rhesus monkey beta-defensin 2 (RhBD-2; Defensin, beta 2; primates, mammals, animals) |
| Source | Macaca mulatta (Rhesus macaque) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9BDS9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11238224 |
Physicochemical Properties
| Residues | 41 |
|---|---|
| Sequence | GIGDPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Molecular Weight | 4361.235 |
| Grand Average of Hydropathy | -0.168 |
| Isoelectric Point | 9.303 |
| Charge at pH 7.4 | 5.432 |
| Secondary Structure | Helix: 0.220, Turn: 0.293, Sheet: 0.073 |
| Instability Index | 38.622 |
| Aromaticity | 0.049 |