| ID | DRAMP03376 |
|---|---|
| Sequence | DLKHLILKAQLARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCINMKELEGST |
| Length | 54 |
| Name | Beta-defensin 11 (BD-11, mBD-11; Defensin, beta 11; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8R2I7, Q499L3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12644567, 19468303 |
Physicochemical Properties
| Residues | 54 |
|---|---|
| Sequence | DLKHLILKAQLARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCINMKELEGST |
| Molecular Weight | 6165.203 |
| Grand Average of Hydropathy | -0.239 |
| Isoelectric Point | 8.31 |
| Charge at pH 7.4 | 1.579 |
| Secondary Structure | Helix: 0.259, Turn: 0.222, Sheet: 0.222 |
| Instability Index | 20.261 |
| Aromaticity | 0.093 |