| ID | DRAMP03429 |
|---|---|
| Sequence | ELKHLGMTAETEWCRLFEGFCHDKNCPPPTSHVGSCHPEKRSCCKDRR |
| Length | 48 |
| Name | Beta-defensin 10 (BD-10, RBD-10; Defensin, beta 10; Rodents, mammals, animals) |
| Source | Rattus norvegicus (Rat) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q32ZI1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 48 |
|---|---|
| Sequence | ELKHLGMTAETEWCRLFEGFCHDKNCPPPTSHVGSCHPEKRSCCKDRR |
| Molecular Weight | 5558.303 |
| Grand Average of Hydropathy | -0.99 |
| Isoelectric Point | 7.878 |
| Charge at pH 7.4 | 0.662 |
| Secondary Structure | Helix: 0.146, Turn: 0.229, Sheet: 0.208 |
| Instability Index | 72.7 |
| Aromaticity | 0.062 |