| ID | DRAMP03658 |
|---|---|
| Sequence | FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ |
| Length | 43 |
| Name | Gallinacin-10 (Gal-10; Beta-defensin 10; Birds, animals) |
| Source | Gallus gallus (Chicken) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q6QLQ9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15148642, 15310403, 17244739 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ |
| Molecular Weight | 4456.118 |
| Grand Average of Hydropathy | 0.095 |
| Isoelectric Point | 8.353 |
| Charge at pH 7.4 | 1.445 |
| Secondary Structure | Helix: 0.186, Turn: 0.279, Sheet: 0.163 |
| Instability Index | 39.516 |
| Aromaticity | 0.07 |