| ID | DRAMP03395 |
|---|---|
| Sequence | LDTIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQKRRWFARSHVYHV |
| Length | 50 |
| Name | Beta-defensin 40 (BD-40, mBD-40; Defensin, beta 40; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q70KL2, Q7TNV5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 14718547 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | LDTIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQKRRWFARSHVYHV |
| Molecular Weight | 5968.969 |
| Grand Average of Hydropathy | -0.522 |
| Isoelectric Point | 9.637 |
| Charge at pH 7.4 | 7.503 |
| Secondary Structure | Helix: 0.300, Turn: 0.180, Sheet: 0.100 |
| Instability Index | 69.368 |
| Aromaticity | 0.12 |
