| ID | DRAMP03392 |
|---|---|
| Sequence | QNNPVAMLDTIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCHKN |
| Length | 46 |
| Name | Beta-defensin 37 (BD-37, mBD-37; Defensin, beta 37; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q7TMD2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 14718547 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | QNNPVAMLDTIACIENKDTCRLKNCPRLHNVVGTCYEGKGKCCHKN |
| Molecular Weight | 5133.934 |
| Grand Average of Hydropathy | -0.602 |
| Isoelectric Point | 8.639 |
| Charge at pH 7.4 | 2.472 |
| Secondary Structure | Helix: 0.196, Turn: 0.239, Sheet: 0.174 |
| Instability Index | 37.652 |
| Aromaticity | 0.022 |