Basic Information
| ID | DRAMP03657 |
|---|
| Sequence | ADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS |
|---|
| Length | 42 |
|---|
| Name | Gallinacin-9 (Gal-9; Beta-defensin 9; Gallinacin-6, Gal-6; Birds, animals) |
|---|
| Source | Gallus gallus (Chicken) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | C.jejuni, C.perfringens, Staphylococcus aureus, Candida albicans and Saccharomyces cerevisiae. Less potent against Salmonella typhimurium and Escherichia coli. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q6QLR1, Q09MS3 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 15148642, 15310403, 17244739, 17194828 |
|---|
