| ID | DRAMP03662 |
|---|---|
| Sequence | ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW |
| Length | 41 |
| Name | Gallinacin-14 (Gal-14; Beta-defensin 14; Birds, animals) |
| Source | Gallus gallus (Chicken) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q0E4V3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17244739, PubMed ID is not available |
Physicochemical Properties
| Residues | 41 |
|---|---|
| Sequence | ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW |
| Molecular Weight | 4700.556 |
| Grand Average of Hydropathy | -0.241 |
| Isoelectric Point | 9.305 |
| Charge at pH 7.4 | 5.506 |
| Secondary Structure | Helix: 0.244, Turn: 0.244, Sheet: 0.146 |
| Instability Index | 45.28 |
| Aromaticity | 0.146 |