| ID | DRAMP03379 |
|---|---|
| Sequence | FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK |
| Length | 45 |
| Name | Beta-defensin 14 (BD-14, mBD-14; Defensin, beta 14; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q7TNV9, Q14BD1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15489334, 18167348 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK |
| Molecular Weight | 5190.247 |
| Grand Average of Hydropathy | -0.636 |
| Isoelectric Point | 10.413 |
| Charge at pH 7.4 | 11.395 |
| Secondary Structure | Helix: 0.222, Turn: 0.222, Sheet: 0.156 |
| Instability Index | 32.471 |
| Aromaticity | 0.067 |