Basic Information
| ID | DRAMP03216 |
| Sequence | GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF |
| Length | 30 |
| Name | Oxyopinin-4a (Oxt-4a; spiders, Arthropods, animals) |
| Source | Oxyopes takobius (Lynx spider) (Oxyopes foliiformis) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | [Ref.21933345]Gram-positive bacteria: S. aureus (MIC=10 µM) and Bacillus subtilis (MIC=0.5 µM);##Gram-negative bacteria: P. fluorescens (MIC=1 µM) and E. coli (MIC=0.5 µM). |
| Hemolytic Activity | [Ref.21933345] EC50=7 μM against human erythrocytes |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot |
F8J4S0, P86350 |
| PDB |
2L3I |
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 21933345 |
|---|