| ID | DRAMP03306 |
|---|---|
| Sequence | GCFEDWSRCSPSTSRGTGVLWRDCDSYCKVCFKADRGECFDSPSLNCPQRLPNNKQCRCINARTAKDNRNPTCWA |
| Length | 75 |
| Name | Theromacin (Annelida, animals) |
| Source | Theromyzon tessulatum (Duck leech) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Micrococcus luteus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q6T6C2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15102860 |
Physicochemical Properties
| Residues | 75 |
|---|---|
| Sequence | GCFEDWSRCSPSTSRGTGVLWRDCDSYCKVCFKADRGECFDSPSLNCPQRLPNNKQCRCINARTAKDNRNPTCWA |
| Molecular Weight | 8527.512 |
| Grand Average of Hydropathy | -0.863 |
| Isoelectric Point | 8.606 |
| Charge at pH 7.4 | 3.305 |
| Secondary Structure | Helix: 0.173, Turn: 0.293, Sheet: 0.120 |
| Instability Index | 57.021 |
| Aromaticity | 0.093 |