| ID | DRAMP03385 |
|---|---|
| Sequence | EFKRCWNGQGACRTFCTRQETFMHLCPDASLCCLSYSFKPSRPSRVGDV |
| Length | 49 |
| Name | Beta-defensin 25 (BD-25, mBD-25; Defensin, beta 25; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KN8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 49 |
|---|---|
| Sequence | EFKRCWNGQGACRTFCTRQETFMHLCPDASLCCLSYSFKPSRPSRVGDV |
| Molecular Weight | 5620.412 |
| Grand Average of Hydropathy | -0.424 |
| Isoelectric Point | 8.684 |
| Charge at pH 7.4 | 2.551 |
| Secondary Structure | Helix: 0.224, Turn: 0.245, Sheet: 0.163 |
| Instability Index | 75.778 |
| Aromaticity | 0.122 |