| ID | DRAMP03394 |
|---|---|
| Sequence | DDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV |
| Length | 51 |
| Name | Beta-defensin 39 (BD-39, mBD-39; Defensin, beta 39; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q70KL3, Q7TNV6 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 14718547 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | DDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV |
| Molecular Weight | 6088.984 |
| Grand Average of Hydropathy | -1.11 |
| Isoelectric Point | 9.218 |
| Charge at pH 7.4 | 5.464 |
| Secondary Structure | Helix: 0.216, Turn: 0.157, Sheet: 0.059 |
| Instability Index | 39.316 |
| Aromaticity | 0.078 |
