| ID | DRAMP03398 |
|---|---|
| Sequence | HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI |
| Length | 50 |
| Name | Beta-defensin 50 (BD-50, mBD-50; Defensin, beta 50; Prostate beta-defensin 1; Rodents, mammals, a |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q6TU36, Q30KM7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 14659016 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI |
| Molecular Weight | 5587.57 |
| Grand Average of Hydropathy | 0.036 |
| Isoelectric Point | 8.407 |
| Charge at pH 7.4 | 1.499 |
| Secondary Structure | Helix: 0.240, Turn: 0.280, Sheet: 0.140 |
| Instability Index | 60.658 |
| Aromaticity | 0.08 |