| ID | DRAMP03525 |
|---|---|
| Sequence | VQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ |
| Length | 51 |
| Name | Apolipophorin-3 (Apolipophorin-III; Insects, animals) |
| Source | Galleria mellonella (Greater wax moth) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Listeria monocytogenes (MIC=6.5 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80703, O76946 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17194500 |
Physicochemical Properties
| Residues | 51 |
|---|---|
| Sequence | VQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ |
| Molecular Weight | 5711.397 |
| Grand Average of Hydropathy | -0.969 |
| Isoelectric Point | 9.058 |
| Charge at pH 7.4 | 1.541 |
| Secondary Structure | Helix: 0.216, Turn: 0.118, Sheet: 0.314 |
| Instability Index | 33.402 |
| Aromaticity | 0.039 |