| ID | DRAMP03561 |
|---|---|
| Sequence | GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
| Length | 77 |
| Name | CXCL6 (C-X-C motif chemokine 6; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial, Antiparasitic |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80162 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 18443119 |
Physicochemical Properties
| Residues | 77 |
|---|---|
| Sequence | GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
| Molecular Weight | 8315.844 |
| Grand Average of Hydropathy | -0.04 |
| Isoelectric Point | 9.749 |
| Charge at pH 7.4 | 7.439 |
| Secondary Structure | Helix: 0.312, Turn: 0.247, Sheet: 0.208 |
| Instability Index | 45.469 |
| Aromaticity | 0.026 |