| ID | DRAMP03559 |
|---|---|
| Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Length | 77 |
| Name | CXCL10 (Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial, Antiparasitic |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P02778, Q96QJ5 |
| PDB | 1O80,1O7Z,1O7Y resolved by X-ray.##1LV9 |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12949249, 12737818 |
Physicochemical Properties
| Residues | 77 |
|---|---|
| Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Molecular Weight | 8646.213 |
| Grand Average of Hydropathy | -0.47 |
| Isoelectric Point | 10.2 |
| Charge at pH 7.4 | 10.407 |
| Secondary Structure | Helix: 0.247, Turn: 0.273, Sheet: 0.221 |
| Instability Index | 64.74 |
| Aromaticity | 0.013 |