| ID | DRAMP03628 |
|---|---|
| Sequence | AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM |
| Length | 38 |
| Name | Beta-defensin 133 (Defensin, beta 133; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KQ1, Q4QY39 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM |
| Molecular Weight | 4461.199 |
| Grand Average of Hydropathy | -0.366 |
| Isoelectric Point | 8.396 |
| Charge at pH 7.4 | 1.547 |
| Secondary Structure | Helix: 0.237, Turn: 0.158, Sheet: 0.184 |
| Instability Index | 45.542 |
| Aromaticity | 0.132 |