| ID | DRAMP03663 |
|---|---|
| Sequence | MTPFWRGVSLRPVGASCRDNSECITMLCRKNRCFLRTASE |
| Length | 40 |
| Name | cLEAP-2 (Chicken LEAP-2; Birds, animals) |
| Source | Gallus gallus (Chicken) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacteria: S. enterica serovar Typhimurium strain SL1344, mutant S. enterica serovar Typhimurium strain phoP. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15557621 |
Physicochemical Properties
| Residues | 40 |
|---|---|
| Sequence | MTPFWRGVSLRPVGASCRDNSECITMLCRKNRCFLRTASE |
| Molecular Weight | 4593.346 |
| Grand Average of Hydropathy | -0.283 |
| Isoelectric Point | 9.368 |
| Charge at pH 7.4 | 3.189 |
| Secondary Structure | Helix: 0.225, Turn: 0.250, Sheet: 0.225 |
| Instability Index | 55.502 |
| Aromaticity | 0.075 |