| ID | DRAMP04267 |
|---|---|
| Sequence | KWKKFIKKIGIGAVLKVLTTGLPALKLTKK |
| Length | 30 |
| Name | CPα2 |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Escherichia coli (MIC=2 μg/ml), Salmonella typhimurium (MIC=2 μg/ml), Pseudomonas aeruginosa K799 (MIC=4 μg/ml), Pseudomonas aeruginosa Z61 (MIC=4 μg/ml), Pseudomonas aeruginosa H744 (MIC=2 μg/ml), Pseudomonas aeruginosa H374 (MIC=4 μg/ml), Pseudomonas aeruginosa H547 (MIC=2 μg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 10085049 |
Physicochemical Properties
| Residues | 30 |
|---|---|
| Sequence | KWKKFIKKIGIGAVLKVLTTGLPALKLTKK |
| Molecular Weight | 3322.209 |
| Grand Average of Hydropathy | 0.213 |
| Isoelectric Point | 10.903 |
| Charge at pH 7.4 | 8.535 |
| Secondary Structure | Helix: 0.400, Turn: 0.133, Sheet: 0.233 |
| Instability Index | -2.963 |
| Aromaticity | 0.067 |