| ID | DRAMP04678 |
|---|---|
| Sequence | DSECLKEYGGDVGFGFCAPRIYPSFCVQRCRADKGALSGKCIWGQGSNVKCLCNFCRHEP |
| Length | 60 |
| Name | Defensin-like protein 4 |
| Source | Brassica napus (Rape) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P80301 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8143882 |
Physicochemical Properties
| Residues | 60 |
|---|---|
| Sequence | DSECLKEYGGDVGFGFCAPRIYPSFCVQRCRADKGALSGKCIWGQGSNVKCLCNFCRHEP |
| Molecular Weight | 6608.529 |
| Grand Average of Hydropathy | -0.282 |
| Isoelectric Point | 8.194 |
| Charge at pH 7.4 | 1.388 |
| Secondary Structure | Helix: 0.250, Turn: 0.283, Sheet: 0.150 |
| Instability Index | 28.403 |
| Aromaticity | 0.117 |