| ID | DRAMP01020 |
|---|---|
| Sequence | RVCMKGSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC |
| Length | 47 |
| Name | SIalpha1 (Plant defensin) |
| Source | Sorghum bicolor |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9715910 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | RVCMKGSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC |
| Molecular Weight | 5382.177 |
| Grand Average of Hydropathy | -0.545 |
| Isoelectric Point | 8.506 |
| Charge at pH 7.4 | 2.462 |
| Secondary Structure | Helix: 0.191, Turn: 0.213, Sheet: 0.170 |
| Instability Index | 51.394 |
| Aromaticity | 0.085 |