| ID | DRAMP18280 |
|---|---|
| Sequence | VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK |
| Length | 32 |
| Name | Plantaricin 163 (Bacteriocin) |
| Source | Lactobacillus plantarum 163 |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | broad-spectrum |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 24228753 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK |
| Molecular Weight | 3553.856 |
| Grand Average of Hydropathy | -0.987 |
| Isoelectric Point | 9.512 |
| Charge at pH 7.4 | 3.496 |
| Secondary Structure | Helix: 0.219, Turn: 0.438, Sheet: 0.125 |
| Instability Index | 32.094 |
| Aromaticity | 0.188 |