| ID | DRAMP18287 |
|---|---|
| Sequence | MSYEKLNNEELSKILGGNGINWGAVAGSCASGAVIGAAFGNPLTGCVANSAFSFSWQAFKNRPRPKKIA |
| Length | 69 |
| Name | Blp1b(Bacteriocin) |
| Source | Lactobacillus salivarius BGHO1 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22739096 |
Physicochemical Properties
| Residues | 69 |
|---|---|
| Sequence | MSYEKLNNEELSKILGGNGINWGAVAGSCASGAVIGAAFGNPLTGCVANSAFSFSWQAFKNRPRPKKIA |
| Molecular Weight | 7176.093 |
| Grand Average of Hydropathy | -0.042 |
| Isoelectric Point | 9.511 |
| Charge at pH 7.4 | 3.224 |
| Secondary Structure | Helix: 0.261, Turn: 0.377, Sheet: 0.261 |
| Instability Index | 12.472 |
| Aromaticity | 0.101 |