| ID | DRAMP00147 |
|---|---|
| Sequence | KNGYGGSGNRWVHCGAGIVGGALIGAIGGPWSAVAGGISGGFTSCR |
| Length | 46 |
| Name | Abp118 beta (Salivaricin CRL1328 beta peptide) |
| Source | Lactobacillus salivarius (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8KWH9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11932444, 19591924 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | KNGYGGSGNRWVHCGAGIVGGALIGAIGGPWSAVAGGISGGFTSCR |
| Molecular Weight | 4333.824 |
| Grand Average of Hydropathy | 0.293 |
| Isoelectric Point | 9.502 |
| Charge at pH 7.4 | 2.54 |
| Secondary Structure | Helix: 0.261, Turn: 0.478, Sheet: 0.130 |
| Instability Index | 18.539 |
| Aromaticity | 0.087 |