| ID | DRAMP00146 |
|---|---|
| Sequence | KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL |
| Length | 45 |
| Name | Abp118 alpha (Salivaricin CRL1328 alpha peptide) |
| Source | Lactobacillus salivarius (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8KWI0 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11932444, 19591924 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL |
| Molecular Weight | 4096.799 |
| Grand Average of Hydropathy | 0.88 |
| Isoelectric Point | 8.956 |
| Charge at pH 7.4 | 1.506 |
| Secondary Structure | Helix: 0.289, Turn: 0.422, Sheet: 0.311 |
| Instability Index | 13.567 |
| Aromaticity | 0.044 |
