| ID | DRAMP00142 |
|---|---|
| Sequence | RNNWAANIGGVGGATVAGWALGNAVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK |
| Length | 57 |
| Name | Gassericin T (gassericin K7 B; Bacteriocin) |
| Source | Lactobacillus gasseri LA158 (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9XDR7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11129595 |
Physicochemical Properties
| Residues | 57 |
|---|---|
| Sequence | RNNWAANIGGVGGATVAGWALGNAVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK |
| Molecular Weight | 5542.278 |
| Grand Average of Hydropathy | 0.46 |
| Isoelectric Point | 9.848 |
| Charge at pH 7.4 | 3.538 |
| Secondary Structure | Helix: 0.281, Turn: 0.333, Sheet: 0.228 |
| Instability Index | 25.909 |
| Aromaticity | 0.105 |