| ID | DRAMP18285 |
|---|---|
| Sequence | TNWKKIGKCYAGTLGSAVLGFGAMGPVGYWAGAGVGYASFC |
| Length | 41 |
| Name | Bacteriocin LS2 (Bacteriocin) |
| Source | Lactobacillus salivarius BGHO1 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | I0B594 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22739096 |
Physicochemical Properties
| Residues | 41 |
|---|---|
| Sequence | TNWKKIGKCYAGTLGSAVLGFGAMGPVGYWAGAGVGYASFC |
| Molecular Weight | 4117.727 |
| Grand Average of Hydropathy | 0.451 |
| Isoelectric Point | 9.184 |
| Charge at pH 7.4 | 2.144 |
| Secondary Structure | Helix: 0.317, Turn: 0.341, Sheet: 0.220 |
| Instability Index | -5.022 |
| Aromaticity | 0.171 |
