| ID | DRAMP00168 |
|---|---|
| Sequence | AAPKITQKQKNCVNGQLGGMLAGALGGPGGVVLGGIGGAIAGGCFN |
| Length | 46 |
| Name | Divergicin A (Bacteriocin) |
| Source | Carnobacterium divergens (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q3SAX6 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7768812, 16385127 |
Physicochemical Properties
| Residues | 46 |
|---|---|
| Sequence | AAPKITQKQKNCVNGQLGGMLAGALGGPGGVVLGGIGGAIAGGCFN |
| Molecular Weight | 4223.899 |
| Grand Average of Hydropathy | 0.426 |
| Isoelectric Point | 9.392 |
| Charge at pH 7.4 | 2.551 |
| Secondary Structure | Helix: 0.239, Turn: 0.413, Sheet: 0.239 |
| Instability Index | 20.65 |
| Aromaticity | 0.022 |