| ID | DRAMP18286 |
|---|---|
| Sequence | ECELAKVDGGYTPKNCAMAVGGGMLSGAIRGGMSGTVFGVGTGNLAGAFAGAHIGLVAGGLACIGGYLGSH |
| Length | 71 |
| Name | Blp1a(Bacteriocin) |
| Source | Lactobacillus salivarius BGHO1 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22739096 |
Physicochemical Properties
| Residues | 71 |
|---|---|
| Sequence | ECELAKVDGGYTPKNCAMAVGGGMLSGAIRGGMSGTVFGVGTGNLAGAFAGAHIGLVAGGLACIGGYLGSH |
| Molecular Weight | 6657.593 |
| Grand Average of Hydropathy | 0.58 |
| Isoelectric Point | 6.976 |
| Charge at pH 7.4 | -0.341 |
| Secondary Structure | Helix: 0.254, Turn: 0.366, Sheet: 0.296 |
| Instability Index | 26.321 |
| Aromaticity | 0.056 |