| ID | DRAMP00141 |
|---|---|
| Sequence | NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN |
| Length | 48 |
| Name | Lactacin-F subunit LafX (Bacteriocin) |
| Source | Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Enterococcus faecalis and other Lactobacilli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q48509 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8285694, 14983040 |
Physicochemical Properties
| Residues | 48 |
|---|---|
| Sequence | NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN |
| Molecular Weight | 4736.285 |
| Grand Average of Hydropathy | 0.198 |
| Isoelectric Point | 8.822 |
| Charge at pH 7.4 | 1.535 |
| Secondary Structure | Helix: 0.250, Turn: 0.375, Sheet: 0.188 |
| Instability Index | 17.785 |
| Aromaticity | 0.125 |