Basic Information
| ID | DRAMP20788 |
|---|
| Sequence | QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW |
|---|
| Length | 42 |
|---|
| Name | Bovine neutrophil Beta-defensin 3 (BNBD-3; cattle, ruminant, mammals; animals) |
|---|
| Source | Bos taurus (Bovine) |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | No MICs found in DRAMP database |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Cyclization of a N-terminal glutamine |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P46161 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 8454635 |
|---|
