| ID | DRAMP02860 |
|---|---|
| Sequence | EGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW |
| Length | 42 |
| Name | Bovine Beta-defensin 3 (bBD-3; BNBD-3; BNDB-3; mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacterium: Staphylococcus aureus 502A (MIC=10-300 µg/ml);##Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P46161 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8454635, 9488394 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | EGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW |
| Molecular Weight | 4834.69 |
| Grand Average of Hydropathy | -0.393 |
| Isoelectric Point | 10.631 |
| Charge at pH 7.4 | 7.554 |
| Secondary Structure | Helix: 0.238, Turn: 0.262, Sheet: 0.024 |
| Instability Index | 25.243 |
| Aromaticity | 0.071 |